Oncotarget

Research Papers:

The antimicrobial peptide pardaxin exerts potent antitumor activity against canine perianal gland adenoma

PDF  |  Full Text  |  Supplementary Files  |  How to cite

Oncotarget. 2015; 6:2290-2301. https://doi.org/10.18632/oncotarget.2959

Metrics: PDF 3391 views  |  Full Text 5403 views

Chieh-Yu Pan1, Chao-Nan Lin2, Ming-Tang Chiou2, Chao Yuan Yu3, Jyh-Yih Chen4 and Chi-Hsien Chien2

1 Department and Graduate Institute of Aquaculture, National Kaohsiung Marine University, Nanzih Dist., Kaohsiung, Taiwan

2 Graduate Institute and Department of Veterinary Medicine, College of Veterinary Medicine, National Pingtung University of Science and Technology, Neipu, Pingtung, Taiwan

3 Genomics BioSci & Tech Co., Ltd., Xizhi Dist., New Taipei, Taiwan

4 Marine Research Station, Institute of Cellular and Organismic Biology, Academia Sinica, Jiaushi, Ilan, Taiwan

Correspondence:

Chi-Hsien Chien, email:

Jyh-Yih Chen, email:

Keywords: antimicrobial peptide, pardaxin, cancer treatment, perianal gland adenoma, canine, intratumoral treatment

Received: October 25, 2014 Accepted: December 09, 2014 Published: December 10, 2014

Abstract

Pardaxin is an antimicrobial peptide of 33 amino acids, originally isolated from marine fish. We previously demonstrated that pardaxin has anti-tumor activity against murine fibrosarcoma, both in vitro and in vivo. In this study, we examined the anti-tumor activity, toxicity profile, and maximally-tolerated dose of pardaxin treatment in dogs with different types of refractory tumor. Local injection of pardaxin resulted in a significant reduction of perianal gland adenoma growth between 28 and 38 days post-treatment. Surgical resection of canine histiocytomas revealed large areas of ulceration, suggesting that pardaxin acts like a lytic peptide. Pardaxin treatment was not associated with significant variations in blood biochemical parameters or secretion of immune-related proteins. Our findings indicate that pardaxin has strong therapeutic potential for treating perianal gland adenomas in dogs. These data justify the veterinary application of pardaxin, and also provide invaluable information for veterinary medicine and future human clinical trials.

INTRODUCTION

For several years, nude mice have been used as in vivo experimental models to study the effects of anti-cancer agents. Working with nude mice allows fine control of the experimental conditions in vivo, and the resulting findings are thus reliable and reproducible. However, the oncogenic processes in transplanted cancer cells in mouse models and naturally-occurring cancers in humans are not the same, and consequently, differences in tumor development and responses are observed [1]. Therefore, it is important to study cancers that develop naturally in the context of an immune system, as this enables observation of tumor growth over long time periods within a syngeneic host, metastasis to relevant distant sites, the development of recurrence, and the tumor microenvironment [2], all of which may play important roles in cancer treatment. Cancer in dogs shares many features with human cancer, including histological morphology, molecular targets, and molecular mechanisms; furthermore, current therapies for human and dog cancer are similar [3, 4]. Several investigations have developed novel treatment options for cancer (including urinary bladder cancer [5], canine osteosarcoma [6], B-cell lymphoma [7], prostatic hyperplasia [8], and solid tumor [9]) using dogs as models, thus emphasizing the importance of studying naturally-occurring cancers in dogs for gaining insights into the biology of human cancer.

We previously reported that intratumoral injection of certain antimicrobial peptides (AMPs) induces anti-tumor responses [10, 11]. The intratumoral injection technique has undergone extensive development, and now enables direct application of drugs to the tumor microenvironment, thereby reducing tumor size [12-14]. Following intratumoral injection, AMPs may engage in electrostatic interactions with the cell membrane, thereby bringing about membrane disruption and rapid necrotic cell death [12, 15-17]. Other studies reported that AMPs not only trigger necrosis through cell membrane lysis, but also activate apoptosis in cancer cells via the mitochondrial lytic effect in the presence of anionic lipids [18-20].

Pardaxin is an AMP originally isolated from a marine fish species (Pardachirus marmoratus); pardaxin has been shown to permeabilize the virion membrane, perturb model membranes of phosphatidyl choline and serine, stimulate calcium uptake in PC12 cells, exhibit ionic channel selectivity, and exert antibacterial and anti-tumor activity [10, 21-25]. Synthetic pardaxin peptide inhibits the proliferation of HT1080 cells in a dose-dependent manner, and induces programmed cell death in HeLa cells [26]. Proteomic analysis revealed that pardaxin triggers apoptotic signaling pathways in HeLa cells, which undergo cross-talk with the unfolded protein response (UPR), the c-Jun pathway, and reactive oxygen species (ROS). Pardaxin plays important roles in the scavenging of ROS to alleviate c-Jun activation; small interfering RNA-mediated knockdown of c-Jun abrogates pardaxin-induced caspase activation and cell death, thereby implicating ROS and c-Jun in pardaxin-induced apoptosis signaling [27]. Transcriptome analysis of pardaxin-treated HT-1080 cells revealed induction of the gene encoding c-FOS, an AP-1 transcription factor. Treatment with pardaxin increased cellular levels of calcium, and blockage of cellular calcium signaling disrupts pardaxin-induced cell death [28]. Injection of pardaxin into the intratumoral space in mice significantly inhibited tumor growth [10]. However, the anti-tumor effects of pardaxin, and their underlying mechanisms, have not been studied in non-murine animal models. In order to elucidate the mode of action of pardaxin in more detail, we performed a pilot study on the anticancer activities of pardaxin administered to canine tumors.

We evaluated the efficacy of pardaxin as an anticancer drug in vivo in a total of 14 dogs with naturally-occurring cancer (nine with mammary gland tumors, one with fibrocarcinoma, two with squamous cell carcinoma, four with perianal gland adenoma, two with histiocytoma, three with malignant mast cell tumor, and one with sarcoma). In addition, the effect of pardaxin on tumor size, immune-related gene expression, and blood biochemical parameters were delineated.

RESULTS

Characteristics of dogs enrolled in this study

The dog patient demographics and tumor types are listed in Table 1. A total of 14 dogs were enrolled into the dose escalation portion of the study. The patient population consisted of dogs of various breeds: mixed breed (n = 7), German Shepherd Dog (n = 1), Golden Retriever (n = 1), Maltese (n = 1), Yorkshire Terrier (n = 1), American Pit Bull Terrier (n = 1), Shih Tzu (n = 1), and Husky (n = 1). The following tumor types were included in the study: mammary gland tumor (n = 9), fibrocarcinoma (n = 1), squamous cell carcinoma (n = 2), perianal gland adenoma (n = 4), histiocytoma (n = 2), malignant mast cell tumor (n = 3), and sarcoma (n = 1).

Table 1: Properties of dogs enrolled in this study.

Number

Medical record numbers

Sex

Age

Breed

Tumor

1

02-13-26

7Y

German Shepherd Dog

Mammary gland tumor

2

02-15-02

20Y

Mix

Mammary gland tumor

3

01-85-03

4-5Y

Golden Retriever

Fibrosarcoma

4

02-14-61

11Y

Mix

Squamous Cell Carcinoma

5

02-09-26

10Y

Maltese

Mammary gland tumor

6

02-15-91

8Y

Mix

Perianal gland adenoma

7

02-16-25

3-4Y

Mix

Histiocytoma

8

02-16-06

14Y

Yorkshire Terrier

Mammary gland tumor

9

02-21-80

7Y

Mix

Malignant Mast Cell Tumor

10

02-22-62

2Y

American Pit Bull Terrier

Histiocytoma

11

02-21-80

7Y

Mix

Malignant Mast Cell Tumor

12

01-70-90-4

9Y

Mix

Sarcoma

13

HW4989

9Y

Shih Tzu

Perianal gland adenoma

14

02-29-90

9Y

Husky

Perianal gland adenoma

Drug administration and anti-tumor activity in tumor-bearing dogs

Dog patients with various tumor types were given daily intratumoral injections of pardaxin at dosages ranging from 0.010 mg/cm2 to 16.666 mg/cm2 (Table 2). Dog patients #1, #2, #5, and #8 had mammary gland tumors; while the volume of the tumor in dog #2 decreased during pardaxin treatment, the growth of the other mammary gland tumors were not substantially affected (Fig. 1a, Table 2). The volume of the fibrosarcoma in dog #3 was decreased at the end of the pardaxin treatment period (Fig. 1b, Table 2). Dog patient #4 bore two squamous cell carcinomas; while the volume of one tumor (B) was no different before and after pardaxin treatment, the volume of the second tumor (A) was decreased (Fig. 1c, Table 2). Dogs #9 and 11 possessed malignant mast cell tumors; the volume of one of the tumors (B) in dog #9 was decreased at the end of the treatment period, while the volumes of the second tumor (A) in dog #9 and the tumor in dog #11 were unaffected (Fig. 1d, Table 2). The volume of the sarcoma in dog #12 was also unaffected by pardaxin treatment (Fig. 1e, Table 2).

fig1afig1bfig1cfig1dfig1e

Figure 1: Change in tumor volume during treatment with pardaxin. (a) Five mammary tumors (of dogs #1, #2, and #5) were monitored for 20 days. (b) One fibrosarcoma tumor (of dog #3) was monitored for 28 days. (c) Two squamous cell carcinomas (of dog #4) were monitored for 28 days. (d) Three malignant mast cell tumors (of dogs #9 and #11) were monitored for 28 days. (e) One sarcoma tumor (of dog #12) was monitored for 28 days. Descriptions of tumor features and pardaxin treatment regimens are provided in Tables 1 and 2. The first day of pardaxin administration is labeled as day one. Each tumor of each dog was injected with a different concentration of pardaxin, and results are plotted using different colors. The tumor volumes (cm3) of individual tumors are shown.

 

Table-2a

Table-2b

Dog patient #6, an 8-year-old, intact, mixed breed male, was observed to bear an intradermal nodule around the anus (3.960 cm2) prior to pardaxin treatment. After 28 days of pardaxin treatment, the perianal gland adenoma had disappeared (Fig 2). On physical examination, the lesion of the perianal area was found to be ulcerated (Fig. 3a). The perianal gland adenoma was surrounded by fibrous capsules and stroma. The dog received a single daily intratumoral injection of 10 mg/ml pardaxin (2 ml/day; pardaxin was dissolved in PBS). At day 19, a significant reduction in perianal gland adenoma volume was observed, and the adenoma mass ultimately burst (Fig. 3a (C, D)). The last day of pardaxin treatment was day 28. The wound remained under observation, and was found to have healed completely by the 121st day (Fig. 3a). Thus, pardaxin treatment resulted in complete regression of tumor tissue of perianal gland adenoma. However, treatment with pardaxin induced rapid adenoma cell lysis, which manifested as a visible necrotic adenoma at 28 days after the first intratumoral injection.

Dog patients #13 and #14 received a single daily intratumoral injection of 10 mg/ml pardaxin (0.5 ml/day). In dog #13, pardaxin treatment resulted in a significant reduction in perianal gland adenoma growth, with the volume decreasing from 1.276 cm2 (pre-treatment) to 0.000 cm2 (post-treatment) (Table 2, Fig. 3b). No obvious necrotic adenoma areas were observed during the treatment period in dog #13 (Fig. 3b). Dog patient #14 possessed two perianal gland adenomas (Fig. 3c, 3d). Both perianal gland adenomas exhibited a decrease in volume; the first tumor decreased from 2.030 cm2 (pre-treatment) to 0.000 cm2 (38 days post-treatment; Fig. 3c), while the second decreased from 3.000 cm2 (pre-treatment) to 0.000 cm2 (31 days post-treatment; Fig. 3d) (Table 2).

fig2

Figure 2: Change in tumor volume during treatment with pardaxin. Four perianal gland adenomas (of dogs #6, #13, and #14) were monitored for 28 days. The first day of pardaxin administration is labeled as day one. Each tumor of each dog was injected with a different concentration of pardaxin, and results are plotted using different colors. The tumor volumes (cm3) of individual tumors are shown. Descriptions of tumor features and pardaxin treatment regimens are provided in Tables 1 and 2.

fig3afig3bfig3cfig3d

Figure 3: Morphological changes in the perianal gland adenoma of dog #6 during treatment with pardaxin for 28 days. (a) (A) Lesions were ulcerated and protruding, due to the masses (arrow) in the 12 o’clock direction from the anus at day 0 (before pardaxin treatment). (B) The 17th day after pardaxin treatment. The perianal gland adenoma exhibits cyanosis and appears black. (C) The 26th day after pardaxin treatment. The perianal gland adenoma had burst open, leaving a hollow aperture. (D) The 33rd day after pardaxin treatment. The wound had begun to heal. (E) The 37th and (F) 121st day after pardaxin treatment. Pardaxin treatment was stopped on the 29th day. (b) Morphological changes in the perianal gland adenoma of dog #13 during treatment with pardaxin for 28 days. (A) Prior to treatment on day 0. (B) The 7th, (C) 14th, (D) 21st, (E) 24th, and (F) 28th day of pardaxin treatment. (c) Morphological changes in the perianal gland adenoma to the upper left of the anus of dog #14 during treatment with pardaxin for 38 days. (A) Prior to treatment on day 0. (B) The 3rd, (C) 11th, (D) 17th, (E) 38th, and (F) 47th day of pardaxin treatment. The green arrow indicates the location of the perianal gland adenoma. (d) Morphological changes in the perianal gland adenoma to the upper right of the anus of dog #14 during treatment with pardaxin for 31 days. (A) Prior to treatment on day 0. (B) The 7th, (C) 17th, (D) 21st, (E) 38th, and (F) 43rd day of pardaxin treatment. The green arrow indicates the location of the perianal gland adenoma.

Dog patients #7 and #10 bore histiocytomas, which were not substantially affected by pardaxin treatment (Fig. 4a, Table 2). Dog #10, a 2-year-old American Pit Bull Terrier, presented with a histiocytoma in the left neck (4.400 cm2) (Fig. 4b). The dog received a single daily intratumoral injection of 10 mg/ml pardaxin (2 ml/day) dissolved in PBS. At day 19, a significant increase in tumor volume was observed, and the tumor mass felt very soft to the touch (Fig. 4b). Pardaxin treatment was halted at day 28. Subsequently, the tumor surface exhibited a small area of cyanosis (Fig. 4b). Surgical excision of the mass after the 28 days of pardaxin treatment revealed pus in the capsule and no significant tumor mass (Fig. 4b). The mass was hollow, with extensive areas of necrosis.

fig4afig4b

Figure 4: Change in tumor volume during treatment with pardaxin. (a) Two histiocytoma tumors (of dogs #7 and #10) were monitored for 28 days. (b) (A) Prior to treatment on day 0 in dog #10. (B) Histiocytoma tumor after 19 days of pardaxin treatment. (C) Surgical excision of the tumor mass after 28 days of treatment with pardaxin; pus can be seen in the capsule, and there was no substantial tumor mass. The mass was hollow with extensive areas of necrosis after 28 days of daily intra-tumoral administration of pardaxin.

DISCUSSION

In the current study, we used pardaxin to treat 14 dogs (belonging to private owners) with different tumor types; this investigation enabled us to identify pardaxin as a potent growth inhibitor of canine perianal gland adenoma in vivo. In recent years, antimicrobial peptides have garnered attention for their therapeutic potential against cancer [29, 30]. Our group has previously shown that intratumoral injection of antimicrobial peptides, such as pardaxin, can inhibit growth of syngeneic fibrosarcoma in a mouse model, without apparent toxic effects [10]. In this study, daily doses of pardaxin, ranging from 1 to 40 mg per dog, did not induce apparent drug-associated toxicity or abnormal blood biochemical parameters in tumor-bearing dogs. Moreover, pardaxin treatment did not significantly affect hematological properties, immune-related protein secretion, or biochemical parameters (Supplementary Table 1; Supplementary Figure 1). The dose-dependent cytotoxic effect of pardaxin was previously demonstrated in vitro (concentration range of 9 to 17 μg pardaxin/ml), by subjecting MN-11 cells to viability assays [10]. In the course of the current study, dog #8 died due to multiple organ dysfunction syndrome, possibly due to metastasis of the cancer. However, the owner did not consent to an autopsy, so we were unable to investigate the possibility of systemic toxicity. With the exception of dog #8, none of the dogs showed any signs of discomfort, pain, or toxicity after the injection of pardaxin.

To assess the effect of pardaxin on solid tumors in vivo, we injected the peptide locally into various tumor types in different dogs. A reduction in tumor growth was observed for all perianal gland adenomas, one squamous cell carcinoma, one fibrosarcoma, and one malignant mast cell tumor. Areas injected with pardaxin showed ulceration (Fig 3a and Fig 4b). Such ulceration in the lesion region was possibly a consequence of the pressure produced by the space-occupying mass or induced by cell necrosis. Induction of necrosis has been a consistent finding in previous studies of the effects of antimicrobial peptide on cancer, including studies of animals with solid tumors [12, 31]. Our earlier findings suggest pardaxin triggers apoptotic signaling pathways in human cervical carcinoma HeLa cells [27], consistent with findings that other antimicrobial peptides induce caspase-dependent apoptosis or programmed cell death of cancer cells via both mitochondrial and death receptor pathways [32, 33]. However, our observation of vacuolation at injected tumor sites in dogs suggests that pardaxin may interact with negatively-charged plasma membranes, causing their disintegration [34, 35]. In addition, pardaxin may be targeted to the endoplasmic reticulum, and mediate cell death by activating c-FOS [28]. However, it remains unknown whether differing doses of pardaxin, or differences in tumor or size, influence the cell lysis, pro-apoptotic, and/or anti-angiogenic effects of pardaxin.

Several earlier studies suggested that pardaxin exerts potent anti-tumor activity in cancer cell lines [10, 20, 27, 28], although the in vivo effects in dog, and the underlying mechanisms, remain unclear. Recent studies suggested that pardaxin induces apoptosis by triggering caspase-dependent and ROS-mediated apoptosis in human fibrosarcoma HT-1080 cells [20]. In the present study, pardaxin was shown to exert concentration- and time-dependent growth inhibition effects on canine perianal gland adenoma. The apoptotic effects of pardaxin were also found to be associated with TNF-α and IL-1β secretion level. Previous studies showed that TNF-α can sensitize MDA-MB-231 cells to Withaferin A and Celastrol, leading to apoptosis [36]. TNF-α induces apoptosis through its interactions with cell surface receptors, such as TNF-α receptor (TNFR) 1 and 2 (extrinsic pathway), and via mitochondrial dysfunction (intrinsic pathway) [37, 38]. It has also been reported that IL-1β induces the apoptosis of cells of the glioblastoma cell line GL15 by causing an imbalance between the MAPK and SAPK pathways [39]. Here, we show that the secretion of TNF-α and IL-1β by tumor-bearing dogs is gradually decreased after administration of pardaxin, implying that pardaxin may induce tumor cell apoptosis at dog tumor sites (Supplementary Figure 1).

This study was a dose-escalating trial; therefore, many dogs received low dosages of pardaxin. Furthermore, most of the dogs had been pre-treated with other drugs, and suffered from an advanced disease state. Therefore, the lack of an effect of pardaxin on the growth of certain tumors may be due to the dog’s health. Partial remission in tumors that are difficult to treat, such as anaplastic mammary carcinoma, was not observed following pardaxin treatment. However, in general, perianal gland adenoma appeared to respond well to treatment with pardaxin. Most perianal gland swellings are focal hyperplasia of the benign proliferation form (adenoma); their counterparts (adenocarcinoma), on the other hand, are rare [40]. Most adenoma is effectively treated with cyclosporine, castration, and tumor removal with surgery [40, 41]. Estrogen treatment is another option for perianal gland adenoma when the owners decline castration. However, estrogen may have serious side effects, such as marrow suppression and fatal anaplastic anemia. Therefore, pardaxin may be considered as a possible candidate to replace estrogen for treatment of perianal gland adenomas in dogs.

From our biochemical analysis of the blood, it follows that treatment of dogs with pardaxin under physiological conditions is conducive to the local release of pardaxin with gradual internalization at the tumor sites; critically, slow internalization and intracellular release augments drug bioavailability. These properties lead to improved therapeutic responses, while avoiding excessive toxicity. Any systemic release of antimicrobial peptide in an intratumor space would be far less harmful than the use of organic compounds. In fact, preclinical toxicology studies in rodents and dogs have shown high tolerability to antimicrobial peptides. For example, the biochemical parameters measured here (Supplementary Table 1) exhibited no significant difference before and after treatment. In dogs, pardaxin did not significantly affect any measured biochemical parameters, including packed cell volume (P.C.V), red blood cell count, hemoglobin, mean cell volume (MCV), mean cell hemoglobin (MCH), mean corpuscular hemoglobin concentration (MCHC), leukocyte number, lymphocyte number, monocyte number, thrombocyte number, plasma, fibrinogen, total protein, T-bilirubin, AST, ALT, albumin, cholesterol, triglyceride, creatinine, blood urea nitrogen (BUN), or uric acid; this is indicative of high tolerability, and little/no toxicity to dog normal tissues. Analyses of enzymological and biochemical profiles of blood are widely used as indicators of the functional status of animal health. Variations in liver enzyme activities (AST, ALT, and T-bilirubin) imply liver dysfunction. An elevation in liver enzymes and/or certain chemicals (bilirubin and creatinine) usually indicates inflammation or damage to cells in the liver. As these liver markers were unaffected/decreased by pardaxin, it appears that treatment at the doses tested did not induce oxidative stress or hepatotoxicity. The biochemical findings were similar to those observed in mouse [10].

To the best of our knowledge, our report is the first to describe the use of an antimicrobial peptide as an anti-tumor agent in dog. We observed clear benefits of antimicrobial peptide therapy in dogs for which alternative treatment options, such as castration and tumor removal by surgery, were not available. In future studies, we may assess the effect(s) of combination(s) of pardaxin with homing peptide and nanoparticles.

CONCLUSIONS

1. Pardaxin treatment has no visible side effects or overall toxicity on tumor-bearing dogs.

2. Pardaxin exhibits anti-tumor activity in tumor-bearing dogs, which is particularly potent against perianal gland adenoma, in which it leads to tumor shrinkage and loss.

3. Together with our previous results on the anti-tumor functions of pardaxin in allogeneic tumors in mice and an all-inclusive set of pre-clinical results, these experimental findings lend further support for future clinical development of pardaxin as a veterinary drug, and possible future suitability for human solid tumor pre-clinical trials.

MATERIALS AND METHODS

Materials

Pardaxin(GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE) was synthesized and purified to a grade of >95% by GL Biochemistry (Shanghai, China). Synthetic peptides were dissolved in sterile deionized water or PBS buffer for the experiments.

Clinical trial eligibility

All animal studies were performed in accordance with protocols approved by the Animal Care and Use Committee of National Pingtung University of Science and Technology. Dogs presented to the animal hospital of National Pingtung University of Science and Technology with histologically-, cytologically-, or morphologically-confirmed neoplastic disease were candidates for enrollment. Written informed consent from the owners of each dog was obtained prior to study enrollment. Surgery, chemotherapy, or other standard therapies were presented as options to owners of dogs with mammary gland tumors, perianal gland adenomas, sarcomas, or other solid tumors. Dogs for which conventional therapy had failed, dogs with owners who wished to try pardaxin treatment, and dogs with owners who declined offers of standard therapy were eligible for enrollment into this study.

Study design and pardaxin peptide administration

A total of 14 privately-owned dogs with spontaneous tumors were enrolled in this study for open-label assessment of the safety and biological activity of pardaxin. Assessment of clinical toxicity and tumor response was performed every day. The dogs lived in the animal hospital, National Pingtung University of Science and Technology, for the duration of the study. Detailed information on dog breed, sex, age, and tumor type are provided in Table 1. Due to the different breeds of dogs included in this study, the body weight varied in the range 3~35 kg, with a mean of 17.78 kg. Dogs treated with pardaxin were subjected to routine blood biochemical parameter checks every 7 days, to evaluate hematological and biochemical toxicity. Pardaxin (0.5 ml to 4 ml) was injected into intratumoral sites at an initial dose of 1 mg/day, 2 mg/day, 4 mg/day, 5 mg/day, 10 mg/day, 20 mg/day, or 40 mg/day. Dog patients #1, #4, #5, and #9 were injected at two sites in the tumor surface. Circles were painted on the tumor, and separated into four quadrants. Pardaxin was injected into the fourth quadrant. Dog #12 was injected at four sites in the tumor surface area. Dogs #2, #3, #6, #7, #8, #10, #11, #13, and #14 were injected with pardaxin at one site in the tumor surface. Tumor size (in three dimensions) was measured every day during the treatment period using calipers. The first day before administration of pardaxin was designated as day 0, and treatment was continued until day 7, 12, 19, or 28. The two tumors of dog #14 were designated as A and B; injection of A was continued for 38 days and injection of B for 31 days. The treatment period duration was dependent on the treatment methods used for different dogs or tumor type (as shown in Table 2). The relationship between peptide dosage and tumor superficial area was defined as mg/cm2. Area was calculated as the product of tumor width and tumor region length.

Blood collection and processing

Blood samples were collected from veins on the 1st, 7th, 14th, 21st, and 28th day during treatment; samples were placed into EDTA tubes and centrifuged at 3000 x g for 10 minutes. Plasma was then collected for analysis of the biochemical parameters listed in Supplementary Table 1. Immune-related proteins (TNF-α, IL-1β, and MIP-1α) were detected by ELISA. Ethical approval was obtained from the Animal Care and Ethics Committee, National Pingtung University of Science and Technology.

In vivo anti-tumor efficacy of pardaxin in tumor-bearing dog

Tumor size was calculated every day followed the formula: volume = length × width2 × 0.5 [28, 42]. The first day of administration was set at day 1.

ACKNOWLEDGMENTS

We would like to thank Dr. Duncan Wright at the editorial office of the Institute of Cellular and Organismic Biology for manuscript editing. Research funding was received from the Marine Research Station (Jiaushi, Ilan), Institute of Cellular and Organismic Biology, Academia Sinica, Taiwan. We acknowledge the support of a 19 months grant and support from the Council of Agriculture, Executive Yuan, R.O.C. (Taiwan) to Dr. Jyh-Yih Chen, entitled “Application and study of the anti-fibrosarcoma activity of the fish antimicrobial peptide, Pardaxin”.

REFERENCES

1. Rangarajan A and Weinberg RA. Opinion: Comparative biology of mouse versus human cells: modelling human cancer in mice. Nat Rev Cancer. 2003;3(12):952-959.

2. Pinho SS, Carvalho S, Cabral J, Reis CA and Gärtner F. Canine tumors: a spontaneous animal model of human carcinogenesis. Transl Res. 2012;159(3):165-172.

3. Vail DM and MacEwen EG. Spontaneously occurring tumors of companion animals as models for human cancer. Cancer Invest. 2000;18(8):781-792.

4. Khanna C, Lindblad-Toh K, Vail D, London C, Bergman P, Barber L, Breen M, Kitchell B, McNeil E, Modiano JF, Niemi S, Comstock KE, Ostrander E, Westmoreland S and Withrow S. The dog as a cancer model. Nat Biotechnol. 2006;24(9):1065-1066.

5. Knapp DW, Ramos-Vara JA, Moore GE, Dhawan D, Bonney PL and Young KE. Urinary bladder cancer in dogs, a naturally occurring model for cancer biology and drug development. ILAR J. 2014;55(1):100-118.

6. Rodriguez CO Jr. Using canine osteosarcoma as a model to assess efficacy of novel therapies: can old dogs teach us new tricks? Adv Exp Med Biol. 2014;804:237-256.

7. Gavazza A, Lubas G, Fridman A, Peruzzi D, Impellizeri JA, Luberto L, Marra E, Roscilli G, Ciliberto G and Aurisicchio L. Safety and efficacy of a genetic vaccine targeting telomerase plus chemotherapy for the therapy of canine B-cell lymphoma. Hum Gene Ther. 2013;24(8):728-738.

8. Chevalier S, Cury FL, Scarlata E, El-Zayat E, Hamel L, Rocha J, Zouanat FZ, Moussa S, Scherz A, Elhilali M and Anidjar M. Endoscopic vascular targeted photodynamic therapy with the photosensitizer WST11 for benign prostatic hyperplasia in the preclinical dog model. J Urol. 2013;190(5):1946-1953.

9. Bentley RT, Mund JA, Pollok KE, Childress MO and Case J. Peripheral blood biomarkers of solid tumor angiogenesis in dogs: a polychromatic flow cytometry pilot study. Vet J. 2013;196(2):236-240.

10. Wu SP, Huang TC, Lin CC, Hui CF, Lin CH and Chen JY. Pardaxin, a fish antimicrobial peptide, exhibits anti-tumor activity toward murine fibrosarcoma in vitro and in vivo. Mar Drugs. 2012;10(8):1852-1872.

11. Lin MC, Lin SB, Chen JC, Hui CF and Chen JY. Shrimp anti-lipopolysaccharide factor peptide enhances the anti-tumor activity of cisplatin in vitro and inhibits HeLa cells growth in nude mice. Peptides. 2010;31(6):1019-1025.

12. Szczepanski C, Tenstad O, Baumann A, Martinez A, Myklebust R, Bjerkvig R and Prestegarden L. Identification of a novel lytic peptide for the treatment of solid tumours. Genes Cancer. 2014;5(5-6):186-200.

13. Shevtsov MA, Kim AV, Samochernych KA, Romanova IV, Margulis BA, Guzhova IV, Yakovenko IV, Ischenko AM and Khachatryan WA. Pilot study of intratumoral injection of recombinant heat shock protein 70 in the treatment of malignant brain tumors in children. Onco Targets Ther. 2014;7:1071-1081.

14. Ren S, Li C, Dai Y, Li N, Wang X, Tian F, Zhou S, Qiu Z, Lu Y, Zhao D, Chen X and Chen D. Comparison of pharmacokinetics, tissue distribution and pharmacodynamics of liposomal and free doxorubicin in tumour-bearing mice following intratumoral injection. J Pharm Pharmacol. 2014;66(9):1231-1239.

15. Hilchie AL, Conrad DM, Coombs MR, Zemlak T, Doucette CD, Liwski RS and Hoskin DW. Pleurocidin-family cationic antimicrobial peptides mediate lysis of multiple myeloma cells and impair the growth of multiple myeloma xenografts. Leuk Lymphoma. 2013;54(10):2255-2262.

16. Hilchie AL, Doucette CD, Pinto DM, Patrzykat A, Douglas S and Hoskin DW. Pleurocidin-family cationic antimicrobial peptides are cytolytic for breast carcinoma cells and prevent growth of tumor xenografts. Breast Cancer Res. 2011;13(5):R102.

17. Chen Y, Xu X, Hong S, Chen J, Liu N, Underhill CB, Creswell K and Zhang L. RGD-Tachyplesin inhibits tumor growth. Cancer Res. 2001;61(6):2434-2438.

18. Giuliani A, Pirri G, Bozzi A, Di Giulio A, Aschi M and Rinaldi AC. Antimicrobial peptides: natural templates for synthetic membrane-active compounds. Cell Mol Life Sci. 2008;65(16):2450-2460.

19. Cerón JM, Contreras-Moreno J, Puertollano E, de Cienfuegos GÁ, Puertollano MA and de Pablo MA. The antimicrobial peptide cecropin A induces caspase-independent cell death in human promyelocytic leukemia cells. Peptides. 2010;31(8):1494-1503.

20. Huang TC, Lee JF and Chen JY. Pardaxin, an antimicrobial peptide, triggers caspase-dependent and ROS-mediated apoptosis in HT-1080 cells. Mar Drugs. 2011;9(10):1995-2009.

21. Huang HN, Pan CY, Chan YL, Chen JY and Wu CJ. Use of the antimicrobial peptide pardaxin (GE33) to protect against methicillin-resistant Staphylococcus aureus infection in mice with skin injuries. Antimicrob Agents Chemother. 2014;58(3):1538-1545.

22. Pal R, Barenholz Y and Wagner RR. Transcription of vesicular stomatitis virus activated by pardaxin, a fish toxin that permeabilizes the virion membrane. J Virol. 1981;39(2):641-645.

23. Saberwal G and Nagaraj R. A synthetic peptide corresponding to the hydrophobic amino terminal region of pardaxin can perturb model membranes of phosphatidyl choline and serine. Biochim Biophys Acta. 1989;984(3):360-364.

24. Nikodijevic B, Nikodijevic D and Lazarovici P. Pardaxin-stimulated calcium uptake in PC12 cells is blocked by cadmium and is not mediated by L-type calcium channels. J Basic Clin Physiol Pharmacol. 1992;3(4):359-370.

25. Shai Y and Oren Z. Diastereoisomers of cytolysins, a novel class of potent antibacterial peptides. J Biol Chem. 1996;271(13):7305-7308.

26. Hsu JC, Lin LC, Tzen JT and Chen JY. Pardaxin-induced apoptosis enhances anti-tumor activity in HeLa cells. Peptides. 2011;32(6):1110-1116.

27. Huang TC and Chen JY. Proteomic analysis reveals that pardaxin triggers apoptotic signaling pathways in human cervical carcinoma HeLa cells: cross talk among the UPR, c-Jun and ROS. Carcinogenesis. 2013;34(8):1833-1842.

28. Ting CH, Huang HN, Huang TC, Wu CJ and Chen JY. The mechanisms by which pardaxin, a natural cationic antimicrobial peptide, targets the endoplasmic reticulum and induces c-FOS. Biomaterials. 2014;35(11):3627-3640.

29. Hoskin DW and Ramamoorthy A. Studies on anticancer activities of antimicrobial peptides. Biochim Biophys Acta. 2008;1778(2):357-375.

30. Schweizer F. Cationic amphiphilic peptides with cancer-selective toxicity. Eur J Pharmacol. 2009;625(1-3):190-194.

31. Gaspar D, Veiga AS and Castanho MA. From antimicrobial to anticancer peptides. A review. Front Microbiol. 2013;4:294.

32. Chen C, Hu J, Zeng P, Pan F, Yaseen M, Xu H and Lu JR. Molecular mechanisms of anticancer action and cell selectivity of short α-helical peptides. Biomaterials. 2014;35(5):1552-1561.

33. Kim IW, Lee JH, Kwon YN, Yun EY, Nam SH, Ahn MY, Kang DC and Hwang JS. Anticancer activity of a synthetic peptide derived from harmoniasin, an antibacterial peptide from the ladybug Harmonia axyridis. Int J Oncol. 2013;43(2):622-628.

34. Vad BS, Bertelsen K, Johansen CH, Pedersen JM, Skrydstrup T, Nielsen NC and Otzen DE. Pardaxin permeabilizes vesicles more efficiently by pore formation than by disruption. Biophys J. 2010;98(4):576-585.

35. Ramamoorthy A, Lee DK, Narasimhaswamy T and Nanga RP. Cholesterol reduces pardaxin’s dynamics-a barrel-stave mechanism of membrane disruption investigated by solid-state NMR. Biochim Biophys Acta. 2010;1798(2):223-227.

36. Lu L, Shi W, Deshmukh RR, Long J, Cheng X, Ji W, Zeng G, Chen X, Zhang Y and Dou QP. Tumor Necrosis Factor-α Sensitizes Breast Cancer Cells to Natural Products with Proteasome-Inhibitory Activity Leading to Apoptosis. PLoS One. 2014;9(11):e113783.

37. Mandal C, Dutta A, Mallick A, Chandra S, Misra L, Sangwan RS and Mandal C. Withaferin A induces apoptosis by activating p38 mitogen-activated protein kinase signaling cascade in leukemic cells of lymphoid and myeloid origin through mitochondrial death cascade. Apoptosis. 2008;13(12):1450-1464.

38. Wang CY, Mayo MW and Baldwin AS Jr. TNF- and cancer therapy-induced apoptosis: potentiation by inhibition of NF-kappaB. Science. 1996;274(5288):784-787.

39. Castigli E, Arcuri C, Giovagnoli L, Luciani R, Giovagnoli L, Secca T, Gianfranceschi GL and Bocchini V. Interleukin-1beta induces apoptosis in GL15 glioblastoma-derived human cell line. Am J Physiol Cell Physiol. 2000;279(6):C2043-2049.

40. Park C, Yoo JH, Kim HJ, Lim CY, Kim JW, Lee SY, Kim JH, Jang JI and Park HM. Cyclosporine treatment of perianal gland adenoma concurrent with benign prostatic hyperplasia in a dog. Can Vet J. 2010;51(11):1279-1282.

41. Javanbakht J, Tavassoli A, Sasani F, Sabbagh A, Hassan MA, Samakkhah SA, Shafiee R, Jani M, Alimohammadi S, Samani R, Barati F and Ghalee VR. An overall assessment of circumanal gland adenoma in a terrier mix breed dog. Asian Pac J Trop Biomed. 2013;3(7):580-583.

42. Ryu JS and Raucher D. Anti-tumor efficacy of a therapeutic peptide based on thermo-responsive elastin-like polypeptide in combination with gemcitabine. Cancer Lett. 2014;348(1-2):177-184.